| Bioactivity | Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite[1]. | ||||||
| Name | Peptide YY (PYY) (3-36), porcine TFA | ||||||
| Sequence | Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr | ||||||
| Shortening | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 | ||||||
| Formula | C176H272N52O54.C2HF3O2 | ||||||
| Molar Mass | 4094.44 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Addison ML, et al. A role for metalloendopeptidases in the breakdown of the gut hormone, PYY 3-36. Endocrinology. 2011 Dec;152(12):4630-40. |
Peptide YY (PYY) (3-36), porcine TFA
CAS: F: C176H272N52O54.C2HF3O2 W: 4094.44
Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.