| Bioactivity | Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembrane perforator that can interact with phospholipid bilayers of different compositions and induce cytotoxicity and pore formation. Pardaxin P 4 can be used in the research of antimicrobial drugs[1]. |
| CAS | 134940-98-0 |
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Gly-Gln-Glu |
| Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE |
| Formula | C154H248N36O45 |
| Molar Mass | 3323.83 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Kolusheva S, et al. Pardaxin, a fish toxin peptide interaction with a biomimetic phospholipid/polydiacetylene membrane assay[J]. Peptides, 2008, 29(9): 1620-1625. |
Pardaxin P 4
CAS: 134940-98-0 F: C154H248N36O45 W: 3323.83
Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembra
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.