| Bioactivity | Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis[1]. | ||||||
| Invitro | Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) are added to the medium, it inhibits osteoblast proliferation in a dose-dependent manner. In another group, bPTH are added to the culture medium from day 1 to day 10, but not from days 11 to 20, a rebound of proliferation is observed in the PTH Day 1–10 group after bPTH withdrawal[1].Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) induces diverse effects on the calcium and phosphorus content of culture medium. The calcium and phosphorus content of culture medium in the PTH-C 100 ng/mL group are higher than in teh control group[1]. Cell Proliferation Assay[1] Cell Line: | ||||||
| Name | Parathyroid Hormone (1-34), bovine | ||||||
| CAS | 12583-68-5 | ||||||
| Shortening | AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF | ||||||
| Formula | C183H288N54O50S2 | ||||||
| Molar Mass | 4108.77 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Parathyroid Hormone (1-34), bovine
CAS: 12583-68-5 F: C183H288N54O50S2 W: 4108.77
Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), b
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.