| Bioactivity | Pancreastatin is a biological active peptide. (Pancreastatin (PST) enhances hepatic glucose output leading to diabetes. ) |
| Name | Pancreastatin |
| CAS | 113817-19-9 |
| Sequence | Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 |
| Shortening | PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 |
| Formula | C138H217N41O50S |
| Molar Mass | 3282.51 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Pancreastatin
CAS: 113817-19-9 F: C138H217N41O50S W: 3282.51
Pancreastatin is a biological active peptide. (Pancreastatin (PST) enhances hepatic glucose output leading to diabetes.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.