| Bioactivity | PEP1 is a biological active peptide. (PEP1 binds to POPC SLBs at Low Concentration, High Concentration of PEP1 Leads to POPC SLBs Lysis) |
| Name | PEP1 |
| Sequence | Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2 |
| Shortening | SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 |
| Formula | C177H259N43O49S |
| Molar Mass | 3805.27 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |