| Bioactivity | Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM[1]. |
| Name | Palicourein |
| CAS | 331714-57-9 |
| Sequence | Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
| Shortening | Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6) |
| Formula | C159H250N48O56S6 |
| Molar Mass | 3922.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bokesch HR, et al. A novel anti-HIV macrocyclic peptide from Palicourea condensata. J Nat Prod. 2001 Feb;64(2):249-50. |
Palicourein
CAS: 331714-57-9 F: C159H250N48O56S6 W: 3922.36
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infec
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.