| Bioactivity | PINT-87aa TFA, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa TFA directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa TFA suppresses glioblastoma cell proliferation in vitro and in vivo[1]. | ||||||
| Invitro | Both 456 and 4121 cells overexpressing PINT-87aa exhibits G1 arrest and reduces cell proliferation without obvious cellular toxicity, whereas PINT-87aa K.O. SW1783 and Hs683 cells shows increased cell cycle and cell proliferation rates[1].The mRNA of PAF1 downstream genes (CPEB1, SOX-2, c-Myc, etc.) is inhibited transcriptionally in PIN87aa-overexpressing 456 and 4121 cells compared with that in control cells[1]. | ||||||
| Name | PINT-87aa TFA | ||||||
| Sequence | Met-Leu-Trp-Leu-Pro-Asp-Arg-Gly-Ser-Cys-Ser-Ala-Arg-Ser-Pro-Ser-Gly-Met-Leu-Arg-Gly-Ala-Pro-Gly-Gly-Trp-Arg-Tyr-Gly-Arg-Arg-Cys-Gly-Arg-Arg-Arg-Gln-Ser-Cys-Cys-Cys-Cys-Cys-Cys-Cys-Ser-His-Val-Gly-Ala-Pro-Leu-Ser-Phe-His-Arg-Glu-Ala-Ser-Leu-Val-Ser-His-Asp-Gly-His-Asp-Ile-Met-Lys-Gln-His-Cys-Gly-Glu-Glu-Ser-Ile-Arg-Gly-Ala-His-Gly-Tyr-Lys-Asn-Lys | ||||||
| Shortening | MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK | ||||||
| Formula | C396H628N140O115S13.C2HF3O2 | ||||||
| Molar Mass | 9721.05 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
PINT-87aa TFA
CAS: F: C396H628N140O115S13.C2HF3O2 W: 9721.05
PINT-87aa TFA, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.