| Bioactivity | PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism[1][2][3]. |
| Name | PHM-27 (human) |
| CAS | 87403-73-4 |
| Sequence | {His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2 |
| Shortening | HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 |
| Formula | C135H214N34O40S |
| Molar Mass | 2985.41 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
PHM-27 (human)
CAS: 87403-73-4 F: C135H214N34O40S W: 2985.41
PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.