PeptideDB

Beta-defensin 1, pig TFA

CAS: F: C323H535N92F3O92S9 W: 7524.92

Beta-defensin 1, pig TFA is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig TFA i
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Beta-defensin 1, pig TFA is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig TFA is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans[1][2].
Invitro Expression of beta-defensin (pBD-1) mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 are kidney and liver, whereas pBD-1 is mainly expressed in tongue[1]. An eight-fold increase in pBD-1 mRNA expression is observed upon S. typhimurium infection in the porcine intestinal cell line IPEC J2[1]. Porcine beta-defensin 1 (pBD-1) also has immunomodulatory activity in porcine peripheral blood mononuclear cells and lymph node cells[3].
Name Beta-defensin 1, pig TFA
Sequence Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala-Lys-Cys-Cys-Ile-Arg
Shortening MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR
Formula C323H535N92F3O92S9
Molar Mass 7524.92
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.