| Bioactivity | Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor[1][2]. | ||||||
| Name | Neuropeptide Y (3-36) (human, rat) | ||||||
| CAS | 150138-78-6 | ||||||
| Sequence | Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 | ||||||
| Shortening | SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | ||||||
| Formula | C175H269N53O54S | ||||||
| Molar Mass | 4011.50 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Hubers SA, et al. DPP (Dipeptidyl Peptidase)-4 Inhibition Potentiates the Vasoconstrictor Response to NPY (Neuropeptide Y) in Humans During Renin-Angiotensin-Aldosterone System Inhibition. Hypertension. 2018;72(3):712-719. [2]. Grandt D, et al. Neuropeptide Y 3-36 is an endogenous ligand selective for Y2 receptors. Regul Pept. 1996;67(1):33-37. |
Neuropeptide Y (3-36) (human, rat)
CAS: 150138-78-6 F: C175H269N53O54S W: 4011.50
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a se
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.