| Bioactivity | Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. | ||||||
| Invitro | Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y[1]. | ||||||
| Name | Neuropeptide Y(29-64) | ||||||
| CAS | 303052-45-1 | ||||||
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr | ||||||
| Shortening | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY | ||||||
| Formula | C189H284N54O58S | ||||||
| Molar Mass | 4272.70 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |