| Bioactivity | Neuropeptide K, human, porcine, rat exhibits bioactivity in gallbladder contraction, protein extravasation, hypotension and brcnchial smooth muscle spasm. Neuropeptide K, human, porcine, rat is concentrated in brain and acts as tachykinin neuromessenger[1]. |
| CAS | 96827-05-3 |
| Sequence | Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 |
| Shortening | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2 |
| Formula | C175H284N52O52S |
| Molar Mass | 3980.51 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Tatemoto K, et al., Neuropeptide K: isolation, structure and biological activities of a novel brain tachykinin. Biochem Biophys Res Commun. 1985 Apr 30;128(2):947-53. |
Neuropeptide K (human, porcine, rat)
CAS: 96827-05-3 F: C175H284N52O52S W: 3980.51
Neuropeptide K, human, porcine, rat exhibits bioactivity in gallbladder contraction, protein extravasation, hypotension
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.