| Bioactivity | Myr5A peptide is an acylated peptide composed of apolipoprotein A1 (ApoA1) analog peptide 5A peptide coupled to the saturated fatty acid myristate. Myr5A peptide self-assembled into lipid nanostructures can be used to encapsulate anthracycline Doxorubicin (HY-15142A) and Valrubicin (HY-13772) for compound release studies in vitro[1]. |
| Sequence | {Myr}-Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp- |
| Shortening | {Myr}-DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA |
| Formula | C211H321N47O57 |
| Molar Mass | 4428.09 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Raut S, et al. Probing the assembly of HDL mimetic, drug carrying nanoparticles using intrinsic fluorescence[J]. Journal of Pharmacology and Experimental Therapeutics, 2020, 373(1): 113-121. |