PeptideDB

Mambalgin-3

CAS: F: C274H433N85O83S10 W: 6566.54

Mambalgin-3 is an acid-sensitive ion channel 1 (ASIC1) inhibitor. Mambalgin-3 can be used in the study of analgesia.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Mambalgin-3 is an acid-sensitive ion channel 1 (ASIC1) inhibitor. Mambalgin-3 can be used in the study of analgesia[1].
Target ASIC1.
Name Mambalgin-3
Sequence Leu-Lys-Cys-Tyr-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Ile-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys19,Cys12-Cys37,Cys41-Cys49,Cys50-Cys55)
Shortening LKCYQHGKVVTCHRDMKFCYHNIGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge: Cys3-Cys19,Cys12-Cys37,Cys41-Cys49,Cys50-Cys55)
Formula C274H433N85O83S10
Molar Mass 6566.54
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Cristofori-Armstrong B, et al. Mambalgin-3 potentiates human acid-sensing ion channel 1b under mild to moderate acidosis: Implications as an analgesic lead. Proc Natl Acad Sci U S A. 2021 Feb 23;118(8):e2021581118.