| Bioactivity | Mambalgin-3 is an acid-sensitive ion channel 1 (ASIC1) inhibitor. Mambalgin-3 can be used in the study of analgesia[1]. |
| Target | ASIC1. |
| Name | Mambalgin-3 |
| Sequence | Leu-Lys-Cys-Tyr-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Ile-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys19,Cys12-Cys37,Cys41-Cys49,Cys50-Cys55) |
| Shortening | LKCYQHGKVVTCHRDMKFCYHNIGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge: Cys3-Cys19,Cys12-Cys37,Cys41-Cys49,Cys50-Cys55) |
| Formula | C274H433N85O83S10 |
| Molar Mass | 6566.54 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Cristofori-Armstrong B, et al. Mambalgin-3 potentiates human acid-sensing ion channel 1b under mild to moderate acidosis: Implications as an analgesic lead. Proc Natl Acad Sci U S A. 2021 Feb 23;118(8):e2021581118. |