| Bioactivity | LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae[1]. |
| Name | LiTx3 |
| Sequence | Gly-Cys-Ile-Lys-Tyr-Gly-Asp-Arg-Cys-Gly-Ser-Pro-His-Gly-Leu-Pro-Ser-Asn-Cys-Cys-Asn-Asp-Trp-Lys-Tyr-Lys-Gly-Arg-Cys-Gly-Cys-Thr-Met-Gly-Val-Cys-Thr-Cys-Gly-Pro-Asn-Cys-Pro-Ser-Arg-Gly-Cys-Asp-Trp-Ser-Lys-Lys-Gly (Disulfide bridge: Cys2-Cys20, Cys9-Cys29, Cys19-Cys38, Cys31-Cys36) |
| Shortening | GCIKYGDRCGSPHGLPSNCCNDWKYKGRCGCTMGVCTCGPNCPSRGCDWSKKG (Disulfide bridge: Cys2-Cys20, Cys9-Cys29, Cys19-Cys38, Cys31-Cys36) |
| Formula | C230H350N74O71S11 |
| Molar Mass | 5640.41 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Matsubara FH, et al. Insecticidal activity of a recombinant knottin peptide from Loxosceles intermedia venom and recognition of these peptides as a conserved family in the genus. Insect Mol Biol. 2017 Feb;26(1):25-34. |