| Bioactivity | Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus[1]. |
| Name | Enterocin Hybrid 1 |
| CAS | 2764845-25-0 |
| Sequence | Met-Lys-Phe-Lys-Phe-Asn-Pro-Thr-Gly-Thr-Ile-Val-Lys-Lys-Leu-Thr-Gln-Tyr-Glu-Ile-Asn-Trp-Tyr-Lys-Gln-Gln-Tyr-Gly-Arg-Tyr-Pro-Trp-Glu-Arg-Pro-Val-Ala |
| Shortening | MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA |
| Formula | C218H323N55O54S |
| Molar Mass | 4610.30 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Diep D, et al. Composition and use. World Intellectual Property Organization, WO2022053707 A1. 2022-03-17. |