Bioactivity | Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity[1]. |
Name | Latartoxin-1a |
Sequence | Glu-Cys-Ile-Pro-Thr-Lys-His-Asp-Cys-Thr-Asn-Asp-Arg-Lys-Asn-Cys-Cys-Pro-Gly-His-Glu-Cys-Lys-Cys-Tyr-Asn-Thr-Gln-Ile-Gly-Gly-Ser-Lys-Lys-Glu-Gln-Cys-Gly-Cys-Lys-Lys-Ser-Leu-Leu-Ala-Lys-Ala-Lys-Asn-Phe-Gly-Gly-Lys-Val-Ile-Thr-Ile-Phe-Lys-Ala (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys39; Cys24-Cys37) |
Shortening | ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys39; Cys24-Cys37) |
Formula | C278H450N84O84S8 |
Molar Mass | 6569.58 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Kuzmenkov AI, et al. Cysteine-rich toxins from Lachesana tarabaevi spider venom with amphiphilic C-terminal segments. Biochim Biophys Acta. 2013 Feb;1828(2):724-31. |