| Bioactivity | GsAF-II is a peptide toxin that blocks hERG1 subtype potassium channels in a voltage-dependent manner. GsAF-II blocks Nav1.x subtype sodium channels[1]. |
| Name | GsAF-II |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Ile-Glu-Trp (Disulfide bonds: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
| Shortening | YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW (Disulfide bonds: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
| Formula | C176H261N47O45S7 |
| Molar Mass | 3979.70 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Redaelli E, et al. Target promiscuity and heterogeneous effects of tarantula venom peptides affecting Na+ and K+ ion channels. J Biol Chem. 2010 Feb 5;285(6):4130-4142. |