| Bioactivity | LL-37 RKS is an active fragment of LL-37[1]. |
| Name | LL-37 RKS |
| CAS | 672345-61-8 |
| Sequence | Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Shortening | RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Formula | C169H292N54O45 |
| Molar Mass | 3800.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Murakami M, et al. Postsecretory processing generates multiple cathelicidins for enhanced topical antimicrobial defense. J Immunol. 2004 Mar 1;172(5):3070-7. |