| Bioactivity | LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing[1][2][3]. | ||||||
| Invitro | LL-37, human TFA (1-20 μg/mL; 24 h) affects HCECs migration[2].LL-37, human TFA (0.0001-5 μg/mL; 6-24 h) affects cytokine secretion in HCECs[2].LL-37, human TFA (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2]. Cell Migration Assay [2] Cell Line: | ||||||
| Name | LL-37, human TFA | ||||||
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser | ||||||
| Shortening | [LL-37, 37 aa] | ||||||
| Formula | C205H340N60O53.C2HF3O2 | ||||||
| Molar Mass | 4607.28 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
LL-37, human TFA
CAS: F: C205H340N60O53.C2HF3O2 W: 4607.28
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectr
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.