PeptideDB

LL-37, human TFA

CAS: F: C205H340N60O53.C2HF3O2 W: 4607.28

LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectr
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing[1][2][3].
Invitro LL-37, human TFA (1-20 μg/mL; 24 h) affects HCECs migration[2].LL-37, human TFA (0.0001-5 μg/mL; 6-24 h) affects cytokine secretion in HCECs[2].LL-37, human TFA (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2]. Cell Migration Assay [2] Cell Line:
Name LL-37, human TFA
Sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Shortening [LL-37, 37 aa]
Formula C205H340N60O53.C2HF3O2
Molar Mass 4607.28
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)