| Bioactivity | Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml[1]. |
| Name | Human β-defensin-3 |
| CAS | 221230-01-9 |
| Sequence | Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
| Shortening | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
| Formula | C216H371N75O59S6 |
| Molar Mass | 5155.17 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Human β-defensin-3
CAS: 221230-01-9 F: C216H371N75O59S6 W: 5155.17
Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial act
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.