| Bioactivity | Human PTH-(1-31) is the 1-31 fragment of human PTH. Human PTH-(1-31) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. Human PTH-(1-31) induces bone formation without inducing bone resorption. Human PTH-(1-31) has the potential for the research of osteoporosis[1][2]. |
| Name | Human PTH-(1-31) |
| CAS | 157938-23-3 |
| Sequence | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val |
| Shortening | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV |
| Formula | C162H269N49O47S2 |
| Molar Mass | 3719.30 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Fraher LJ, et al. Comparison of the biochemical responses to human parathyroid hormone-(1-31)NH2 and hPTH-(1-34) in healthy humans. J Clin Endocrinol Metab. 1999 Aug;84(8):2739-43. [2]. K. Henriksen, et al. Evaluation of the efficacy, safety and pharmacokinetic profile of oral recombinant human parathyroid hormone [rhPTH(1-31)NH2] in postmenopausal women with osteoporosis. Bone. 2013, 53 (1): 160-166. |
Human PTH-(1-31)
CAS: 157938-23-3 F: C162H269N49O47S2 W: 3719.30
Human PTH-(1-31) is the 1-31 fragment of human PTH. Human PTH-(1-31) stimulates the release of cAMP and also is a weaker
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.