| Bioactivity | GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively[1]. |
| Target | IC50: 0.04 μM (Nav1.7), 0.33 μM (Nav1.4), 0.36 μM (Nav1.1), 0.6 μM (Nav1.2), 1.2 μM (Nav1.6), 1.28 μM (Nav1.3), 4.8 μM (hERG1) |
| Name | GsAF-I |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Leu-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
| Shortening | YCQKWLWTCDSERKCCEDMVCRLWCKKRL-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
| Formula | C160H244N46O42S7 |
| Molar Mass | 3708.39 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Redaelli E, et al. Target promiscuity and heterogeneous effects of tarantula venom peptides affecting Na+ and K+ ion channels. J Biol Chem. 2010 Feb 5;285(6):4130-4142. |