PeptideDB

GpTx-1

CAS: 1661050-12-9 F: C176H271N53O45S7 W: 4073.82

GpTx-1 is a potent and selective NaV1.7 antagonist with an IC50 of 10 nM.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity GpTx-1 is a potent and selective NaV1.7 antagonist with an IC50 of 10 nM[1].
Target IC50: 10 nM (hNaV1.7), 0.2 μM (hNaV1.4)
Name GpTx-1
CAS 1661050-12-9
Sequence Asp-Cys-Leu-Gly-Phe-Met-Arg-Lys-Cys-Ile-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Thr-His-Lys-Trp-Cys-Lys-Tyr-Val-Phe-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Shortening DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2 (Disulfide bridge: Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Formula C176H271N53O45S7
Molar Mass 4073.82
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Murray JK, et al. Engineering potent and selective analogues of GpTx-1, a tarantula venom peptide antagonist of the Na(V)1.7 sodium channel. J Med Chem. 2015 Mar 12;58(5):2299-314.