| Bioactivity | GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration ([Ca2+]i), and capable of enhancing exocytosis[1]. |
| Name | GIP (1-39) |
| CAS | 725474-97-5 |
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn |
| Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
| Formula | C210H316N56O61S |
| Molar Mass | 4633.21 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Xie L, et al. GIP1-39, a novel insulinotropic peptide form and aspects on its mechanism of action. Regul Pept. 2004 Sep 15;121(1-3):107-12. |
GIP (1-39)
CAS: 725474-97-5 F: C210H316N56O61S W: 4633.21
GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion f
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.