| Bioactivity | Gletimbetasin is a thymosin β4 analog with anti-inflammatory activity. |
| CAS | 921944-96-9 |
| Sequence | Gly-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser |
| Shortening | GSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Formula | C212H351N57O78S |
| Molar Mass | 4978.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. WHO Drug Information. Volume 38, No. 2. |