| Bioactivity | Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA[1]. |
| Name | Garvicin KS, GakC |
| CAS | 2098351-26-7 |
| Sequence | Met-Gly-Ala-Ile-Ile-Lys-Ala-Gly-Ala-Lys-Ile-Val-Gly-Lys-Gly-Ala-Leu-Thr-Gly-Gly-Gly-Val-Trp-Leu-Ala-Glu-Lys-Leu-Phe-Gly-Gly-Lys |
| Shortening | MGAIIKAGAKIVGKGALTGGGVWLAEKLFGGK |
| Formula | C143H240N38O36S |
| Molar Mass | 3099.73 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Thapa RK, et al. Preformulation studies on novel garvicin KS peptides for topical applications. Eur J Pharm Sci. 2020 Aug 1;151:105333. |
Garvicin KS, GakC
CAS: 2098351-26-7 F: C143H240N38O36S W: 3099.73
Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.