Galanin-Like Peptide (human)_product_DataBase

CAS: 245114-99-2 F: C292H451N83O84S W: 6500.28

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in th

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism[1].
Name	Galanin-Like Peptide (human)
CAS	245114-99-2
Sequence	Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser
Shortening	APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Formula	C292H451N83O84S
Molar Mass	6500.28
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Satoshi Hirako, et al. Galanin-like Peptide Ameliorates Obesity by Control of Food Intake and Energy Metabolism. Pharm Anal Acta 2014, 5:5.

PeptideDB