| Bioactivity | Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and proinflammatory genes[1]. |
| Name | Endotrophin (Mus musculus) |
| CAS | 1678414-54-4 |
| Sequence | Thr-Glu-Pro-Leu-Phe-Leu-Thr-Lys-Thr-Asp-Ile-Cys-Lys-Leu-Ser-Arg-Asp-Ala-Gly-Thr-Cys-Val-Asp-Phe-Lys-Leu-Leu-Trp-His-Tyr-Asp-Leu-Glu-Ser-Lys-Ser-Cys-Lys-Arg-Phe-Trp-Tyr-Gly-Gly-Cys-Gly-Gly-Asn-Glu-Asn-Arg-Phe-His-Ser-Gln-Glu-Glu-Cys-Glu-Lys-Met-Cys-Ser-Pro-Glu-Leu-Thr-Val |
| Shortening | TEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV |
| Formula | C345H526N92O106S7 |
| Molar Mass | 7882.88 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yueshui Zhao, et al. Divergent functions of endotrophin on different cell populations in adipose tissue. Am J Physiol Endocrinol Metab. 2011, 311, 6. |