Endotrophin (Mus musculus)_product_DataBase

CAS: 1678414-54-4 F: C345H526N92O106S7 W: 7882.88

Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and proinflammatory genes[1].
Name	Endotrophin (Mus musculus)
CAS	1678414-54-4
Sequence	Thr-Glu-Pro-Leu-Phe-Leu-Thr-Lys-Thr-Asp-Ile-Cys-Lys-Leu-Ser-Arg-Asp-Ala-Gly-Thr-Cys-Val-Asp-Phe-Lys-Leu-Leu-Trp-His-Tyr-Asp-Leu-Glu-Ser-Lys-Ser-Cys-Lys-Arg-Phe-Trp-Tyr-Gly-Gly-Cys-Gly-Gly-Asn-Glu-Asn-Arg-Phe-His-Ser-Gln-Glu-Glu-Cys-Glu-Lys-Met-Cys-Ser-Pro-Glu-Leu-Thr-Val
Shortening	TEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV
Formula	C345H526N92O106S7
Molar Mass	7882.88
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Yueshui Zhao, et al. Divergent functions of endotrophin on different cell populations in adipose tissue. Am J Physiol Endocrinol Metab. 2011, 311, 6.

PeptideDB