| Bioactivity | GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion[1]. | ||||||
| Name | GLP-1(7-37) acetate | ||||||
| CAS | 1450806-98-0 | ||||||
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly | ||||||
| Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | ||||||
| Formula | C153H232N40O49 | ||||||
| Molar Mass | 3415.72 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
GLP-1(7-37) acetate
CAS: 1450806-98-0 F: C153H232N40O49 W: 3415.72
GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.