| Bioactivity | GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone[1][2]. |
| Invitro | GHRF, porcine (50 pM) induces GH release in rat anterior pituitary cells[1]. |
| Name | GHRF, porcine |
| CAS | 88384-73-0 |
| Shortening | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2 |
| Formula | C219H365N73O66S |
| Molar Mass | 5108.76 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
GHRF, porcine
CAS: 88384-73-0 F: C219H365N73O66S W: 5108.76
GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.