| Bioactivity | Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer[1][2]. |
| Invitro | Epidermal growth factor (EGF) (500 ng/mL; 0-20 min) can induce the production of ROS in A431 cells[1].Epidermal growth factor (EGF)-induced tyrosine phosphorylation of various cellular proteins was completely blocked in A431 cells containing exogenous catalase[1]. |
| Name | Epidermal growth factor (EGF) |
| CAS | 62253-63-8 |
| Shortening | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42) |
| Formula | C270H395N73O83S7 |
| Molar Mass | 6215.98 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Epidermal growth factor (EGF)
CAS: 62253-63-8 F: C270H395N73O83S7 W: 6215.98
Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) sig
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.