| Bioactivity | Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1[1][2][3][4]. |
| Name | Echistatin |
| CAS | 154303-05-6 |
| Shortening | ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge:Cys2-Cys11;Cys7-Cys32;Cys8-Cys37;Cys20-Cys39) |
| Formula | C217H341N71O74S9 |
| Molar Mass | 5417.00 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Echistatin
CAS: 154303-05-6 F: C217H341N71O74S9 W: 5417.00
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms,
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.