| Bioactivity | ELA-32 (human) is a potent critical cardiac developmental peptide that acts through the G-protein–coupled apelin receptor[1]. |
| Name | ELA-32(human) |
| CAS | 1680205-79-1 |
| Shortening | QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) |
| Formula | C170H289N63O39S4 |
| Molar Mass | 3967.82 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
ELA-32(human)
CAS: 1680205-79-1 F: C170H289N63O39S4 W: 3967.82
ELA-32 (human) is a potent critical cardiac developmental peptide that acts through the G-protein–coupled apelin recept
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.