| Bioactivity | Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi[1]. |
| Name | Dermaseptin-S2 |
| CAS | 151896-13-8 |
| Sequence | Ala-Leu-Trp-Phe-Thr-Met-Leu-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His-Ala-Gly-Lys-Ala-Ala-Leu-Gly-Ala-Ala-Ala-Asn-Thr-Ile-Ser-Gln-Gly-Thr-Gln |
| Shortening | ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ |
| Formula | C155H255N43O43S2 |
| Molar Mass | 3473.08 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Mor A, et al. The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms. J Biol Chem. 1994 Dec 16;269(50):31635-41. |