| Bioactivity | Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily[1]. |
| Name | Dermaseptin-B9 |
| CAS | 1235883-50-7 |
| Sequence | Ala-Leu-Trp-Lys-Thr-Ile-Ile-Lys-Gly-Ala-Gly-Lys-Met-Ile-Gly-Ser-Leu-Ala-Lys-Asn-Leu-Leu-Gly-Ser-Gln-Ala-Gln-Pro-Glu-Ser |
| Shortening | ALWKTIIKGAGKMIGSLAKNLLGSQAQPES |
| Formula | C139H236N38O40S |
| Molar Mass | 3111.66 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Amiche M, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008 Nov;29(11):2074-82. |