| Bioactivity | Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform[1]. | ||||||
| Name | Dendrotoxin K TFA | ||||||
| Sequence | Ala-Ala-Lys-Tyr-Cys-Lys-Leu-Pro-Leu-Arg-Ile-Gly-Pro-Cys-Lys-Arg-Lys-Ile-Pro-Ser-Phe-Tyr-Tyr-Lys-Trp-Lys-Ala-Lys-Gln-Cys-Leu-Pro-Phe-Asp-Tyr-Ser-Gly-Cys-Gly-Gly-Asn-Ala-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Val-Gly (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51) | ||||||
| Shortening | AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG (Disulfide bridge:Cys5-Cys55,Cys14-Cys38,Cys30-Cys51) | ||||||
| Formula | C294H462N84O75S6.XC2HF3OC2 | ||||||
| Molar Mass | 6559.66 (free base) | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. Bialowas A, et al. Analog modulation of spike-evoked transmission in CA3 circuits is determined by axonal Kv1.1 channels in a time-dependent manner. Eur J Neurosci. 2015 Feb;41(3):293-304. |