Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42)_product_DataBase

CAS: 1802086-21-0 F: C220H343N63O64S2 W: 4958.59

Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) can be used in research of Alzheimer's disease[1].
Name	Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42)
CAS	1802086-21-0
Shortening	CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Formula	C220H343N63O64S2
Molar Mass	4958.59
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB