PeptideDB

Copeptin (rat)

CAS: 86280-64-0 F: C183H307N57O61 W: 4281.74

Copeptin (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Copeptin (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1].
Name Copeptin (rat)
CAS 86280-64-0
Sequence Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr
Shortening AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Formula C183H307N57O61
Molar Mass 4281.74
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54.