| Bioactivity | Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B[1]. |
| Target | Human rhinovirus, S. aureus |
| Name | Citrullinated LL-37 1cit |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-{Cit}-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Shortening | LLGDFF-{Cit}-KSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Formula | C205H339N59O54 |
| Molar Mass | 4494.25 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Casanova V, et al. Citrullination Alters the Antiviral and Immunomodulatory Activities of the Human Cathelicidin LL-37 During Rhinovirus Infection. Front Immunol. 2020 Feb 4;11:85. |