| Bioactivity | Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively[1]. |
| Target | IC50: 8 nM (Nav1.2/β1), 88 nM (Nav1.3/β1), 400 nM (Nav1.4/β1), 407 nM (Nav1.1/β1), 1634 nM (Nav1.5/β1) |
| Name | Ceratotoxin-2 |
| CAS | 880885-98-3 |
| Sequence | Asp-Cys-Leu-Gly-Trp-Phe-Lys-Ser-Cys-Asp-Pro-Lys-Asn-Asp-Lys-Cys-Cys-Lys-Asn-Tyr-Thr-Cys-Ser-Arg-Arg-Asp-Arg-Trp-Cys-Lys-Tyr-Tyr-Leu-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Shortening | DCLGWFKSCDPKNDKCCKNYTCSRRDRWCKYYL-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29) |
| Formula | C177H260N52O49S6 |
| Molar Mass | 4092.67 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bosmans F, et al. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol Pharmacol. 2006 Feb;69(2):419-29. |
Ceratotoxin-2
CAS: 880885-98-3 F: C177H260N52O49S6 W: 4092.67
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.