| Bioactivity | Calcitonin (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of drug research and development[1]. |
| Name | Calcitonin (rat) |
| CAS | 11118-25-5 |
| Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Shortening | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge: Cys1-Cys7) |
| Formula | C148H228N40O46S3 |
| Molar Mass | 3399.83 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
Calcitonin (rat)
CAS: 11118-25-5 F: C148H228N40O46S3 W: 3399.83
Calcitonin (rat), is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that poo
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.