| Bioactivity | Calcitonin, porcine inhibits 1,25 (OH)2D3-stimulated porcine osteoclast differentiation. Calcitonin is a polypeptide hormone that can lower serum calcium by decreasing calcium reabsorption in the kidney and inhibiting osteoclastic bone resorption. Calcitonin, porcine can be used for research of hypercalcemia[1][2]. |
| CAS | 12321-44-7 |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH2 (Disulfidebridge:Cys1-Cys7) |
| Shortening | CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2 (Disulfidebridge:Cys1-Cys7) |
| Formula | C159H232N46O45S3 |
| Molar Mass | 3604.02 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Galvin RJ, et al. Calcitonin responsiveness and receptor expression in porcine and murine osteoclasts: a comparative study. Bone. 1998 Sep;23(3):233-40. [2]. Kammerman S, et al. Effect of porcine calcitonin on hypercalcemia in man. J Clin Endocrinol Metab. 1970 Jul;31(1):70-5. |