PeptideDB

CRAMP (140-173) (mouse)

CAS: F: C178H302N50O46 W: 3878.61

CRAMP (140-173) (mouse) is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) inhibits LPS (HY-D10
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity CRAMP (140-173) (mouse) is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) inhibits LPS (HY-D1056)-induced responses, and can not colocalized with TLR3 in BEAS-2B cells[1].
Name CRAMP (140-173) (mouse)
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln
Shortening GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Formula C178H302N50O46
Molar Mass 3878.61
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Singh D, et al. The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway. J Biol Chem. 2013;288(12):8258-8268.