| Bioactivity | CRAMP (1-39) is an antimicrobial peptide. CRAMP (1-39) has shown potent bactericidal effects against multiple strains of Neisseria meningitidis in vitro. CRAMP (1-39) can be used to study drug-resistant bacterial infections[1]. |
| Sequence | Ile-Ser-Arg-Leu-Ala-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln |
| Shortening | ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Formula | C202H346N58O52 |
| Molar Mass | 4419.27 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bergman P, et al. Induction of the antimicrobial peptide CRAMP in the blood-brain barrier and meninges after meningococcal infection[J]. Infection and immunity, 2006, 74(12): 6982-6991. |