PeptideDB

Brain Natriuretic Peptide-45, rat

CAS: 123337-89-3 F: C213H349N71O65S3 W: 5040.67

Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency[1].
In Vivo Brain Natriuretic Peptide-45, rat (BNP-45, rat; 0.1, 0.2, 0.5, 1.0 and 2.0 nmol/kg, i.v.) shows potent natriuretic and hypotensive activities in anesthetized spontaneously hypertensive rats (SHR) and Wistar-Kyoto rats (WKY). Brain Natriuretic Peptide-45, rat with high concentration decreases blood pressure in SHR. But WKY is more susceptible than SHR to BNP-45 for diuresis, natriuresis and urinary cGMP excretion. In addition, high dose of Brain Natriuretic Peptide-45, rat cuases prolonged lowering of blood pressure and urinary cGMP excretion in WKY[1].
Name Brain Natriuretic Peptide-45, rat
CAS 123337-89-3
Sequence Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39)
Shortening SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39)
Formula C213H349N71O65S3
Molar Mass 5040.67
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Kita T, et al. Effects of brain natriuretic peptide-45, a circulating form of rat brain natriuretic peptide, in spontaneously hypertensive rats. Eur J Pharmacol. 1991 Sep 4;202(1):73-9.