| Bioactivity | Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively[1]. |
| Name | Bovine tracheal antimicrobial peptide |
| Sequence | Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Shortening | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Formula | C169H296N58O45S7 |
| Molar Mass | 4084.98 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Diamond G, et al. Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA. Proc Natl Acad Sci U S A. 1991 May 1;88(9):3952-6. |
Bovine tracheal antimicrobial peptide
CAS: F: C169H296N58O45S7 W: 4084.98
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine trac
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.