| Bioactivity | Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM[1]. |
| Name | Jingzhaotoxin-II |
| Sequence | Gly-Cys-Gly-Thr-Met-Trp-Ser-Pro-Cys-Ser-Thr-Glu-Lys-Pro-Cys-Cys-Asp-Asn-Phe-Ser-Cys-Gln-Pro-Ala-Ile-Lys-Trp-Cys-Ile-Trp-Ser-Pro (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) |
| Shortening | GCGTMWSPCSTEKPCCDNFSCQPAIKWCIWSP (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys28) |
| Formula | C154H219N39O45S7 |
| Molar Mass | 3561.08 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Meichi Wang, et al. Jingzhaotoxin-II, a novel tarantula toxin preferentially targets rat cardiac sodium channel. Biochem Pharmacol. 2008 Dec 15;76(12):1716-27. |
Jingzhaotoxin-II
CAS: F: C154H219N39O45S7 W: 3561.08
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-I
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.