| Bioactivity | Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo[1]. |
| Invitro | Endothelin-1 (ET-1) is a potent, endothelial cell-derived, 21-amino acid peptide that has potent vasoconstricting properties and may participate in the regulation of blood pressure and regional blood flow[1]. |
| In Vivo | Big Endothelin-1 (1-39), porcine, the cDNA deduced putative precursor of ET-1, has been reported to have similar pressor effects in vivo[1]. |
| Name | Big Endothelin-1 (1-39), porcine |
| CAS | 120796-99-8 |
| Shortening | CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) |
| Formula | C193H289N49O58S5 |
| Molar Mass | 4384.10 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. A Hoffman, et al. Opposite effects of endothelin-1 and Big-endothelin-(1-39) on renal function in rats. Eur J Pharmacol. 1990 Jul 17;182(3):603-6. |
Big Endothelin-1 (1-39), porcine
CAS: 120796-99-8 F: C193H289N49O58S5 W: 4384.10
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.