| Bioactivity | Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide[1]. | ||||||
| Name | Big Endothelin-1 (1-38), human | ||||||
| CAS | 120796-97-6 | ||||||
| Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) | ||||||
| Shortening | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11) | ||||||
| Formula | C189H282N48O56S5 | ||||||
| Molar Mass | 4282.92 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
Big Endothelin-1 (1-38), human
CAS: 120796-97-6 F: C189H282N48O56S5 W: 4282.92
Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.